Preview

International Journal of Veterinary Medicine

Advanced search

Design and production of recombinant multiepitope antigen to indicate antibodies against the virus arthritis-encephalitis of goats

https://doi.org/10.52419/issn2072-2419.2025.1.25

Abstract

To date, the only effective means of combating goat arthritis-encephalitis viruses (CAEV) includes its early diagnosis and slaughter of all animals in dysfunctional and suspected farms, since specific preventive measures have not been developed. Among the widely available tools for diagnostic studies, PCR indication of the CAEV genome and the detection of specific antibodies of the virus can be distinguished, which directly depends on the serological activity and specificity of the antigens used in diagnostic kits. This work is devoted to the development of a recombinant antigen for serological indication of antibodies against CAEV. As a result of bioinformatic analysis, a search was performed for amino acid sequences of virus proteins, an analysis of immunogenic epitopes of these proteins, a search for N-, O-glycosylation sites, signal peptide sites and transmembrane domains. Based on the data obtained, a recombinant multiepitope antigen was designed with the following amino acid sequence "mqktnepyedfaarlleaidaepipvgaeiipesmkylrgaksqgklneeaerwrrnnppppavraytygviempenyakvcqplvqiyrtlstptyqhhhhhh». The constructed amino acid sequence, after converting it to a nucleotide one, taking into account the codon optimization of protein production in Escherichia coli, was cloned into an expression construct based on the pET28a(+) vector. As a result of the design, the length of the created plasmid for the expression of the nucleotide sequence of the CAEV was 5527 bp. The protein developed and purified by affinity chromatography, containing amino acid sequences of immunogenic epitopes of the CAEV antigens, confirmed its functionality in indirect solid-phase enzyme immunoassay using blood sera from goats with previously confirmed immune status to this virus. The recombinant multiepitope antigen presented in this paper can be widely used as an integral component in the development of diagnostic test systems.

About the Authors

N. I. Khammadov
FSBSI «Federal Center for Toxicological, Radiation and Biological Safety»; FSBEI HE «Kazan State Academy of Veterinary Medicine named after N.E. Bauman»
Russian Federation

Кhammadov N.I. – Candidate of Biological Sciences, Leading Researcher



A. G. Galeeva
FSBSI «Federal Center for Toxicological, Radiation and Biological Safety»; FSBEI HE «Kazan State Academy of Veterinary Medicine named after N.E. Bauman»
Russian Federation

Galeeva A.G. – Candidate of Veterinary Sciences, Senior researcher, head of the Lab of Viral Antropozoonoses 



M. E. Gorbunova
FSBSI «Federal Center for Toxicological, Radiation and Biological Safety»
Russian Federation

Gorbunova M.E. - Candidate of Biological Sciences, Researcher



G. R. Salmanova
FSBSI «Federal Center for Toxicological, Radiation and Biological Safety»
Russian Federation

Salmanova G.R. – postgraduate student



E. A. Gromova
FSBSI «Federal Center for Toxicological, Radiation and Biological Safety»
Russian Federation

Gromova E.A. – Candidate of Biological Sciences, Senior researcher



A. I. Khamidullina
FSBEI HE «Kazan State Academy of Veterinary Medicine named after N.E. Bauman»
Russian Federation

Khamidullina A.I. - 5th year student of the Faculty of Veterinary Medicine 



M. A. Efimova
FSBSI «Federal Center for Toxicological, Radiation and Biological Safety»; FSBEI HE «Kazan State Academy of Veterinary Medicine named after N.E. Bauman»
Russian Federation

Efimova M.A. – Doctor of Biological Sciences, leading researcher 



References

1. Larruskain A., Jugo B. Retroviral infections in sheep and goats: small ruminant lentiviruses and host interaction. Viruses. 2013; 5(8):2043-2061.

2. Strizhakov A.A., Tsybanov S.Zh., Chichikin A.Yu., Yurkov S.G., Volkova I.Yu., Zhigaleva O.N., Burdinskyi V.G., Zhivoderov S.P. The disease of calves associated with virus of arthritis and encephalitis of goats. Veterinary medicine. 2005; 8:21-22. (In Russ.)

3. Koptev V.Yu., Schkiel N.A., Balybina N.Yu., Penkova I.N. Identification of seropositive caprine arthritis-encephalitis goats in the territorial entities of the Russian Federation. Bulletin of Altai State Agricultural University. 2022; 9(215):60-65.

4. Pokrovskaya E.S., Shuralev E.A., Mukminov M.N., Elizarova I.A., Faizov T.Kh. Antigenic clusters of transmembrane and capsid proteins of caprine arthritis encephalitis virus and their bioinformatic analysis. The Veterinarian. 2015; 6:6-22. (In Russ.)

5. Gromova E.A., Mirkhazov D.A., Dodonova E.A., Elizarova I.A., Gorbunova M.E., Osyanin K.A. Development of a multiplex RT-PCR test system for detecting the causative agent of brucellosis. The Veterinarian. 2024; 3:34-40.

6. Anisimova E.A., Fakhrutdinov N.A., Mirgazov D.A., Dodonova E.A., Elizarova I.A., Gorbunova M.E., Khammadov N.I., Zainullin L.I., Osyanin K.A. Bacillus anthracis strain differentiation based on SNP and VNTR loci. Vavilovskii Zhurnal Genetiki i Selektsii=Vavilov Journal of Genetics and Breeding. 2022;26(6):560-567. Doi 10.18699/VJGB-22-68. (In Russ.)

7. Akhmadeev R.M., Arslanova A.F., Aleeva Z.Z., Yarullina G.M., Arutyunyan G.S. Epizootic situation and prevention of animal rabies in the Republic of Tatarstan. The Veterinarian. 2021; 6:11-19.

8. Galeeva A.G., Efimova M.A., Zakirova E.Yu., Кhammadov N.I., Khisamutdinov A.G., Garipov L.N., Mingaleev D.N., Ravilov R.H. Optimization of the protocol for the assembly of recombinant adenoas-sociated serotype 2 viruses for the delivery of African swine fever virus genes into mammalian cells. International bulletin of Veterinary Medicine. 2024; 1:22-31. doi 10.52419/issn2072-2419.2024.1.22. (In Russ.)

9. Safina R.F., Salmanova G.R., Usoltsev K.V., Khammadov N.I., Faizov T.Kh. Incidence of animal retroviruses in areas of the Republic of Tatarstan. Scientific Notes Kazan Bauman State Academy of Veterinary Medicine. 2022; 249(1):183-188. Doi 10.31588/2413_4201_1883_1_249_183. (In Russ.)

10. Koptev V.Yu., Shkil N.A., Balybina N.Yu., Penkova I.N. Clinical signs of caprine arthritis-encephalitis and diseaserelated pathomorphological changes. Veterinary science today. 2023; 12(2):126-132.

11. Penkova, I.N., Balybina N.Yu., Koptev V.Yu. Identification of seropositive for arthritis-encephalitis of goat animals on the territory of the Siberian Federal District. Agrarian science - agriculture : A collection of materials of the XVII International Scientific and Practical Conference. In 2 books, Barnaul, February 09-10, 2022. Volume 2. Barnaul: Altai State Agrarian University, 2022; 202-203. (In Russ.)

12. Gorbunova M.E., Usoltsev K.V., Shangaraev R.I., Gromova E.A., Khaertynov K.S., Galeeva A.G. Purification of bovine leukemia virus antigens by ultracentrifugation. The Veterinarian. 2024; 2:43-48. Doi 10.33632/1998-698X_2024_2_43. (In Russ.)

13. Shustov A.V., Eskendirova S.Z., Manat E., Unysheva G.B., Sarina N.I. Preparation of recombinant brucella-Cu/Zn-dependent superoxide dismutase (SOD) antigen. Biotechnology. Theory and practice. 2013; 3:65-70. (In Russ.)

14. Ausubel F.M., Brent R., Kingston R.E., Moore D.D., Seidman J.G., Smith J.A., Struhl K. Current Protocols in Molecular Biologyhttps [Electronic resource]. Avaliable at: //hoclai.wordpress.com/wpcontent/uploads/2015/09/current-protocolsin-molecular-biology.pdf (accessed 05.08.2024)

15. Lukmanova G.R. Indication of the goat arthritis-encephalitis virus in PCR-RV and search for genetic markers. Scientific Notes Kazan Bauman State Academy of Veterinary Medicine. 2020; 242(2):97-101.


Review

For citations:


Khammadov N.I., Galeeva A.G., Gorbunova M.E., Salmanova G.R., Gromova E.A., Khamidullina A.I., Efimova M.A. Design and production of recombinant multiepitope antigen to indicate antibodies against the virus arthritis-encephalitis of goats. International Journal of Veterinary Medicine. 2025;(1):25-37. (In Russ.) https://doi.org/10.52419/issn2072-2419.2025.1.25

Views: 154


Creative Commons License
This work is licensed under a Creative Commons Attribution 4.0 License.


ISSN 2072-2419 (Print)